PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009777580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 293aa    MW: 31850.4 Da    PI: 9.2722
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009777580.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3969128362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e+ lkcprCdstntkfCy+nnysl+qPr+fCk+CrryWtkGGa+rnvPvGgg+r+nk+s+
  XP_009777580.1  69 EAGLKCPRCDSTNTKFCYFNNYSLTQPRHFCKSCRRYWTKGGAMRNVPVGGGCRRNKRSK 128
                     6779*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3452121IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3271126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.61872126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MIFSSFPVYL DHPNLQQLQQ SDHQQGNSGL ENPQLPPHQL PAQVGGGLGS IRPGSMVDRA  60
RMAKIPLPEA GLKCPRCDST NTKFCYFNNY SLTQPRHFCK SCRRYWTKGG AMRNVPVGGG  120
CRRNKRSKSS NNNSNNNISK STGGQMGNSN VIISTSASPS SCSMEIIGHQ FSQPSTQFTP  180
LMAAFHNLNN YGGGFGTEMG FQIANNNNNN NNLLPSLAAN FEHTTNLYSF QVQGESTIEA  240
SNGVSQVTPP VKMESNSTKQ FLGSLENNQY WGGANSWIGF SGLNNSSTTS HLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777580.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4D9L41e-111K4D9L4_SOLLC; Uncharacterized protein
STRINGSolyc11g066050.1.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-43OBF-binding protein 3